PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00155153001
Common NameGSBRNA2T00155153001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 419aa    MW: 47087.9 Da    PI: 6.9657
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00155153001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.6e-3288141255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtpeLH +F++ave+LGG+++AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  GSBRNA2T00155153001  88 PRLRWTPELHLCFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRS 141
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-3084142IPR009057Homeodomain-like
PROSITE profilePS5129413.32184144IPR017930Myb domain
SuperFamilySSF466893.94E-1685143IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-2488143IPR006447Myb domain, plants
PfamPF002491.0E-989140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MTPSSQSSEN SKTCPSNNFK ATTTKEDDDK DEEEEEEEEE DEEERSADQS PSSNSYVEES  60
RSQHHHNNND QIKKKGGSVR PYNRSKTPRL RWTPELHLCF LQAVERLGGP DRATPKLVLQ  120
LMNVKGLSIA HVKSHLQMYR SKKTDDLNQG NLLLLGDQGF SFEHGAGYTY NLSQLPMLQS  180
FDQGPSTSLG YGGGLWIDHR RQVYRSPWRG LTARDNTRTR QTLFSSQLGE RFLGVSNSIL  240
DDKNKTISFR TNSREAAHAS NGIGEAVPRS HSSFLEGMKT FNKSWGQSFP SNPNPSMPSK  300
PQDHTAVTLN FHQSDNPRVG EETENDLKRK RLLLSGDYNK SNQDLDLCLS LKVPPTHNNL  360
GECLLEEGEK EHEDSKRLSL SLSSSSLSQH GRAIRKEDQN DHKKRKISVL ASPLDLTL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00155153001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325720.0AC232572.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS005G02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013693001.10.0PREDICTED: two-component response regulator ARR1-like isoform X2
TrEMBLA0A078DV940.0A0A078DV94_BRANA; BnaC04g46900D protein
STRINGBra004973.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93592136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-173G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]